PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400043079
Common NameLOC102601859
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 560aa    MW: 62800.5 Da    PI: 4.7414
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400043079genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS444.76.5e-1361915593374
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           + L++cA a+++g+ e+a++++++l++++s +gdp++R aay++eALaar+a s+ +lykal+++e++   sse+l+a+++++ev+P++
  PGSC0003DMP400043079 191 QMLFSCAAAIQDGHIEQASSMINELRQMVSIQGDPLERTAAYMVEALAARMATSGRGLYKALKCKEAT---SSERLSAMQVLFEVCPYF 276
                           79*****************************************************************9...9***************** PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           +f++++aN aIlea++ e+rvHiiDfd++qG Q+ +Llq+Las p++pp++R+Tgv++pes+      l+ +g rLa++A+ l+++fef
  PGSC0003DMP400043079 277 RFGFMAANGAILEAFKDEKRVHIIDFDLNQGSQYYTLLQTLASMPGKPPHVRLTGVDDPESVqrAIGGLNVIGLRLAELAKDLKISFEF 365
                           ************************************************************99777789********************* PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                           ++ v++++  +++ +L+++pgEa+ Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++Fl+rf+e  +yy ++
  PGSC0003DMP400043079 366 QA-VSSNTGLVTPAMLNCRPGEAVLVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTAPFLQRFAEVYNYYCVV 453
                           **.7************************************************************************************* PP

                  GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                           f+sl+a+l+r+s+er++vEr++l+r+i n+vaceg er+er e ++kWr+r+++aGF+p p+s +++++++ l+++++++ y+ eee g
  PGSC0003DMP400043079 454 FESLDATLSRDSQERVNVERQCLARDIINIVACEGLERIERYEVAGKWRARMMMAGFTPSPISRNVYDSIRNLIKQYSER-YKAEEEAG 541
                           ******************************************************************************66.******** PP

                  GRAS 357 slvlgWkdrpLvsvSaWr 374
                           +l++gW+d++L+++SaWr
  PGSC0003DMP400043079 542 ALYFGWEDKTLTVASAWR 559
                           *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.001163540IPR005202Transcription factor GRAS
PfamPF035142.2E-133191559IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MSLVRSLRSI GNGKLYFQNG HDDNSSLSTS MYSKNARGIM YATESSSTDS YDPKYLLESP  60
SPSEELLTTS PTDVLGNPFH QRHSSSFHPS RDYNQASYDS GDFVNQSPDS SEYNDGRVTM  120
KLQELERVLF DDNEIEGDDV FTRGETMDID DEWFNQIRTE LLQESTSADS NISSSSSYKE  180
ISVSAPQTPK QMLFSCAAAI QDGHIEQASS MINELRQMVS IQGDPLERTA AYMVEALAAR  240
MATSGRGLYK ALKCKEATSS ERLSAMQVLF EVCPYFRFGF MAANGAILEA FKDEKRVHII  300
DFDLNQGSQY YTLLQTLASM PGKPPHVRLT GVDDPESVQR AIGGLNVIGL RLAELAKDLK  360
ISFEFQAVSS NTGLVTPAML NCRPGEAVLV NFAFQLHHMP DESVSTVNQR DQLLRMVKSL  420
NPKLVTVVEQ DMNTNTAPFL QRFAEVYNYY CVVFESLDAT LSRDSQERVN VERQCLARDI  480
INIVACEGLE RIERYEVAGK WRARMMMAGF TPSPISRNVY DSIRNLIKQY SERYKAEEEA  540
GALYFGWEDK TLTVASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-611915596375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006356310.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_006356311.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_006356312.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_006356313.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLM1CBH60.0M1CBH6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000639440.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]